PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59667.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 146aa    MW: 16745.3 Da    PI: 9.0964
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59667.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.53.2e-27959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                k+ien   rqvtfskRr g+lKKA EL vLCdaevaviifsstgk+y+++s
  EPS59667.1  9 KKIENVNSRQVTFSKRRGGLLKKARELAVLCDAEVAVIIFSSTGKMYDFAS 59
                68***********************************************86 PP

2K-box45.53.2e-16921461569
       K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                  +++ e++ Lk+eie L+  qR++ G+dLe L++ +L+ Le+qL +++ ++++kK
  EPS59667.1  92 HEYSSEVKHLKNEIEALKLRQRQMTGKDLEGLTYSDLHDLENQLMEGILSVKDKK 146
                 57999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.127161IPR002100Transcription factor, MADS-box
CDDcd002651.76E-41274No hitNo description
SuperFamilySSF554553.14E-32274IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-293859IPR002100Transcription factor, MADS-box
Gene3DG3DSA:1.10.1280.106.6E-462139IPR008922Uncharacterised domain, di-copper centre
PROSITE profilePS512979.61891146IPR002487Transcription factor, K-box
PfamPF014861.4E-1291146IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009910Biological Processnegative regulation of flower development
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MGRGKIEIKK IENVNSRQVT FSKRRGGLLK KARELAVLCD AEVAVIIFSS TGKMYDFASS  60
RMDQILARYN QSNECLEIVT VEHAAEQVKF RHEYSSEVKH LKNEIEALKL RQRQMTGKDL  120
EGLTYSDLHD LENQLMEGIL SVKDKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-23274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-23274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-23274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-23274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075339.12e-70PREDICTED: MADS-box transcription factor 23
SwissprotQ9M2K89e-49AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBLS8DJJ61e-104S8DJJ6_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0006s04730.16e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87752226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.16e-50AGAMOUS-like 18
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]